SERPINA1 polyclonal antibody View larger

SERPINA1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERPINA1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SERPINA1 polyclonal antibody

Brand: Abnova
Reference: PAB30249
Product name: SERPINA1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human SERPINA1.
Isotype: IgG
Gene id: 5265
Gene name: SERPINA1
Gene alias: A1A|A1AT|AAT|MGC23330|MGC9222|PI|PI1|PRO2275
Gene description: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Immunogen: Recombinant protein corresponding to amino acids of human SERPINA1.
Immunogen sequence/protein sequence: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Protein accession: P01009
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30249-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SERPINA1 polyclonal antibody (Cat # PAB30249) shows moderate extra-cellular positivity in tubule cells and positivity of plasma in blood vesse at 1:200 - 1:500 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SERPINA1 polyclonal antibody now

Add to cart