MCM5 polyclonal antibody View larger

MCM5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCM5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about MCM5 polyclonal antibody

Brand: Abnova
Reference: PAB30248
Product name: MCM5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human MCM5.
Isotype: IgG
Gene id: 4174
Gene name: MCM5
Gene alias: CDC46|MGC5315|P1-CDC46
Gene description: minichromosome maintenance complex component 5
Immunogen: Recombinant protein corresponding to amino acids of human MCM5.
Immunogen sequence/protein sequence: NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLY
Protein accession: P33992
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30248-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with MCM5 polyclonal antibody (Cat # PAB30248) shows strong nuclear positivity in cells in seminiferus ducts at 1:500 - 1:1000 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MCM5 polyclonal antibody now

Add to cart