KLK3 polyclonal antibody View larger

KLK3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KLK3 polyclonal antibody

Brand: Abnova
Reference: PAB30246
Product name: KLK3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human KLK3.
Isotype: IgG
Gene id: 354
Gene name: KLK3
Gene alias: APS|KLK2A1|PSA|hK3
Gene description: kallikrein-related peptidase 3
Immunogen: Recombinant protein corresponding to amino acids of human KLK3.
Immunogen sequence/protein sequence: SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Protein accession: P07288
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30246-48-33-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with KLK3 polyclonal antibody (Cat # PAB30246) shows strong cytoplasmic positivity in glandular cells at 1:2500 - 1:5000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KLK3 polyclonal antibody now

Add to cart