ATG10 polyclonal antibody View larger

ATG10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ATG10 polyclonal antibody

Brand: Abnova
Reference: PAB30243
Product name: ATG10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ATG10.
Isotype: IgG
Gene id: 83734
Gene name: ATG10
Gene alias: APG10|APG10L|DKFZp586I0418|FLJ13954|pp12616
Gene description: ATG10 autophagy related 10 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human ATG10.
Immunogen sequence/protein sequence: IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM
Protein accession: Q9H0Y0
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30243-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with ATG10 polyclonal antibody (Cat # PAB30243) shows moderate membranous and cytoplasmic positivity in glandular cells at 1:50 - 1:200 dilution.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ATG10 polyclonal antibody now

Add to cart