GABARAPL2 polyclonal antibody View larger

GABARAPL2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GABARAPL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about GABARAPL2 polyclonal antibody

Brand: Abnova
Reference: PAB30242
Product name: GABARAPL2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human GABARAPL2.
Isotype: IgG
Gene id: 11345
Gene name: GABARAPL2
Gene alias: ATG8|GATE-16|GATE16|GEF-2|GEF2
Gene description: GABA(A) receptor-associated protein-like 2
Immunogen: Recombinant protein corresponding to amino acids of human GABARAPL2.
Immunogen sequence/protein sequence: SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE
Protein accession: P60520
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30242-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with GABARAPL2 polyclonal antibody (Cat # PAB30242) shows distinct cytoplasmic positivity in purkinje cells at 1:500 - 1:1000 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy GABARAPL2 polyclonal antibody now

Add to cart