GNPTG polyclonal antibody View larger

GNPTG polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNPTG polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about GNPTG polyclonal antibody

Brand: Abnova
Reference: PAB30236
Product name: GNPTG polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human GNPTG.
Isotype: IgG
Gene id: 84572
Gene name: GNPTG
Gene alias: C16orf27|GNPTAG|LP2537|RJD9
Gene description: N-acetylglucosamine-1-phosphate transferase, gamma subunit
Immunogen: Recombinant protein corresponding to amino acids of human GNPTG.
Immunogen sequence/protein sequence: PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG
Protein accession: Q9UJJ9
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30236-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with GNPTG polyclonal antibody (Cat # PAB30236) shows strong cytoplasmic positivity in glandular cells at 1:50 - 1:200 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy GNPTG polyclonal antibody now

Add to cart