ICAM1 polyclonal antibody View larger

ICAM1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ICAM1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ICAM1 polyclonal antibody

Brand: Abnova
Reference: PAB30231
Product name: ICAM1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human ICAM1.
Isotype: IgG
Gene id: 3383
Gene name: ICAM1
Gene alias: BB2|CD54|P3.58
Gene description: intercellular adhesion molecule 1
Immunogen: Recombinant protein corresponding to amino acids 333 - 477 of human ICAM1.
Immunogen sequence/protein sequence: EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP
Protein accession: P05362
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:250 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30231-48-1-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung shows distinct membranous positivity in alveolar cells with ICAM1 polyclonal antibody (Cat # PAB30231).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ICAM1 polyclonal antibody now

Add to cart