CTSO polyclonal antibody View larger

CTSO polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSO polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CTSO polyclonal antibody

Brand: Abnova
Reference: PAB30230
Product name: CTSO polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CTSO.
Isotype: IgG
Gene id: 1519
Gene name: CTSO
Gene alias: CTSO1
Gene description: cathepsin O
Immunogen: Recombinant protein corresponding to amino acids 71 - 176 of human CTSO.
Immunogen sequence/protein sequence: QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTL
Protein accession: P43234
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30230-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach shows strong cytoplasmic positivity in glandular cells with CTSO polyclonal antibody (Cat # PAB30230).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CTSO polyclonal antibody now

Add to cart