CD14 polyclonal antibody View larger

CD14 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD14 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CD14 polyclonal antibody

Brand: Abnova
Reference: PAB30223
Product name: CD14 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CD14.
Isotype: IgG
Gene id: 929
Gene name: CD14
Gene alias: -
Gene description: CD14 molecule
Immunogen: Recombinant protein corresponding to amino acids 24 - 147 of human CD14.
Immunogen sequence/protein sequence: PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Protein accession: P08571
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30223-48-70-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bone marrow shows moderate cytoplasmic positivity with CD14 polyclonal antibody (Cat # PAB30223).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD14 polyclonal antibody now

Add to cart