SRF polyclonal antibody View larger

SRF polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRF polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SRF polyclonal antibody

Brand: Abnova
Reference: PAB30221
Product name: SRF polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SRF.
Isotype: IgG
Gene id: 6722
Gene name: SRF
Gene alias: MCM1
Gene description: serum response factor (c-fos serum response element-binding transcription factor)
Immunogen: Recombinant protein corresponding to amino acids 339 - 467 of human SRF.
Immunogen sequence/protein sequence: LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ
Protein accession: P11831
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30221-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney shows strong nuclear positivity in cells in glomeruli with SRF polyclonal antibody (Cat # PAB30221).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SRF polyclonal antibody now

Add to cart