Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB30215 |
Product name: | CRKL polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human CRKL. |
Isotype: | IgG |
Gene id: | 1399 |
Gene name: | CRKL |
Gene alias: | - |
Gene description: | v-crk sarcoma virus CT10 oncogene homolog (avian)-like |
Immunogen: | Recombinant protein corresponding to amino acids 125 - 301 of human CRKL. |
Immunogen sequence/protein sequence: | LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE |
Protein accession: | P46109 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube shows membranous and cytoplasmic positivity in glandular cells with CRKL polyclonal antibody (Cat # PAB30215). |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |