TYRP1 polyclonal antibody View larger

TYRP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TYRP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about TYRP1 polyclonal antibody

Brand: Abnova
Reference: PAB30213
Product name: TYRP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human TYRP1.
Isotype: IgG
Gene id: 7306
Gene name: TYRP1
Gene alias: CAS2|CATB|GP75|TRP|TYRP|b-PROTEIN
Gene description: tyrosinase-related protein 1
Immunogen: Recombinant protein corresponding to amino acids 257- 377 of human TYRP1.
Immunogen sequence/protein sequence: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Protein accession: P17643
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30213-48-72-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin shows distinct cytoplasmic positivity in melanocytes with TYRP1 polyclonal antibody (Cat # PAB30213).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TYRP1 polyclonal antibody now

Add to cart