HNRNPA3 polyclonal antibody View larger

HNRNPA3 polyclonal antibody

New product

369,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HNRNPA3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about HNRNPA3 polyclonal antibody

Brand: Abnova
Reference: PAB30136
Product name: HNRNPA3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPA3.
Gene id: 220988
Gene name: HNRNPA3
Gene alias: 2610510D13Rik|D10S102|FBRNP|HNRPA3|MGC138232|MGC142030
Gene description: heterogeneous nuclear ribonucleoprotein A3
Genbank accession: NM_194247
Immunogen: A synthetic peptide corresponding to N-terminus of human HNRNPA3.
Immunogen sequence/protein sequence: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Protein accession: NP_919223;P51991
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30136-48-multi-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung (A) and human liver (B) with HNRNPA3 polyclonal antibody (Cat # PAB30136) at 4-8 ug/mL working concentration.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy HNRNPA3 polyclonal antibody now

Add to cart