Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GNAS polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about GNAS polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30105 |
| Product name: | GNAS polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human GNAS. |
| Gene id: | 2778 |
| Gene name: | GNAS |
| Gene alias: | AHO|C20orf45|GNAS1|GPSA|GSA|GSP|MGC33735|NESP|PHP1A|PHP1B|POH|dJ309F20.1.1|dJ806M20.3.3 |
| Gene description: | GNAS complex locus |
| Genbank accession: | NM_080426 |
| Immunogen: | A synthetic peptide corresponding to N-terminus of human GNAS. |
| Immunogen sequence/protein sequence: | SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
| Protein accession: | NP_536351;Q5FWY2 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung (A) and human kidney (B) with GNAS polyclonal antibody (Cat # PAB30105) at 4-8 ug/mL working concentration. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |