FTCD polyclonal antibody View larger

FTCD polyclonal antibody

PAB30090_100uL

New product

369,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FTCD polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about FTCD polyclonal antibody

Brand: Abnova
Reference: PAB30090
Product name: FTCD polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human FTCD.
Gene id: 10841
Gene name: FTCD
Gene alias: LCHC1
Gene description: formiminotransferase cyclodeaminase
Genbank accession: NM_006657
Immunogen: A synthetic peptide corresponding to N-terminus of human FTCD.
Immunogen sequence/protein sequence: FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
Protein accession: NP_006648;O95954
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30090-48-72-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with FTCD polyclonal antibody (Cat # PAB30090) at 4-8 ug/mL working concentration.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FTCD polyclonal antibody now

Add to cart