CIZ1 polyclonal antibody View larger

CIZ1 polyclonal antibody

PAB30000_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIZ1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CIZ1 polyclonal antibody

Brand: Abnova
Reference: PAB30000
Product name: CIZ1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human CIZ1.
Gene id: 25792
Gene name: CIZ1
Gene alias: LSFR1|NP94|ZNF356
Gene description: CDKN1A interacting zinc finger protein 1
Genbank accession: NM_012127
Immunogen: A synthetic peptide corresponding to C-terminus of human CIZ1.
Immunogen sequence/protein sequence: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Protein accession: NP_036259;Q9ULV3
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30000-48-1-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with CIZ1 polyclonal antibody (Cat # PAB30000) at 4-8 ug/mL working concentration.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CIZ1 polyclonal antibody now

Add to cart