BHMT polyclonal antibody View larger

BHMT polyclonal antibody

New product

369,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BHMT polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,IHC-P

More info about BHMT polyclonal antibody

Brand: Abnova
Reference: PAB29977
Product name: BHMT polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human BHMT.
Gene id: 635
Gene name: BHMT
Gene alias: -
Gene description: betaine-homocysteine methyltransferase
Genbank accession: NM_001713
Immunogen: A synthetic peptide corresponding to N-terminus of human BHMT.
Immunogen sequence/protein sequence: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
Protein accession: NP_001704;Q93088
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: PAB29977-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with BHMT polyclonal antibody (Cat # PAB29977) at 4-8 ug/mL working concentration.
Applications: WB-Ce,WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy BHMT polyclonal antibody now

Add to cart