Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB29971 |
Product name: | ASPH polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human ASPH. |
Gene id: | 444 |
Gene name: | ASPH |
Gene alias: | BAH|CASQ2BP1|HAAH|JCTN|junctin |
Gene description: | aspartate beta-hydroxylase |
Genbank accession: | NM_020164 |
Immunogen: | A synthetic peptide corresponding to N-terminus of human ASPH. |
Immunogen sequence/protein sequence: | SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE |
Protein accession: | NP_064549;Q12797 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (2.5 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with ASPH polyclonal antibody (Cat # PAB29971) at 4-8 ug/mL working concentration. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |