Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALDH4A1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about ALDH4A1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29957 |
| Product name: | ALDH4A1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human ALDH4A1. |
| Gene id: | 8659 |
| Gene name: | ALDH4A1 |
| Gene alias: | ALDH4|P5CD|P5CDh|P5CDhL|P5CDhS |
| Gene description: | aldehyde dehydrogenase 4 family, member A1 |
| Genbank accession: | NM_001161504 |
| Immunogen: | A synthetic peptide corresponding to N-terminus of human ALDH4A1. |
| Immunogen sequence/protein sequence: | QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL |
| Protein accession: | Q5TF55 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (2.5 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with ALDH4A1 polyclonal antibody (Cat # PAB29957) at 4-8 ug/mL working concentration. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |