SFRS17A polyclonal antibody View larger

SFRS17A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRS17A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SFRS17A polyclonal antibody

Brand: Abnova
Reference: PAB29955
Product name: SFRS17A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human SFRS17A.
Gene id: 8227
Gene name: SFRS17A
Gene alias: 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y
Gene description: splicing factor, arginine/serine-rich 17A
Genbank accession: NM_005088
Immunogen: A synthetic peptide corresponding to N-terminus of human SFRS17A.
Immunogen sequence/protein sequence: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD
Protein accession: NP_005079;Q02040
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29955-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SFRS17A polyclonal antibody (Cat # PAB29955) at 4-8 ug/mL working concentration.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SFRS17A polyclonal antibody now

Add to cart