Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB29955 |
Product name: | SFRS17A polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human SFRS17A. |
Gene id: | 8227 |
Gene name: | SFRS17A |
Gene alias: | 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y |
Gene description: | splicing factor, arginine/serine-rich 17A |
Genbank accession: | NM_005088 |
Immunogen: | A synthetic peptide corresponding to N-terminus of human SFRS17A. |
Immunogen sequence/protein sequence: | NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD |
Protein accession: | NP_005079;Q02040 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (0.2-1 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SFRS17A polyclonal antibody (Cat # PAB29955) at 4-8 ug/mL working concentration. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |