Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD151 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IF |
More info about CD151 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29946 |
| Product name: | CD151 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human CD151. |
| Gene id: | 977 |
| Gene name: | CD151 |
| Gene alias: | GP27|MER2|PETA-3|RAPH|SFA1|TSPAN24 |
| Gene description: | CD151 molecule (Raph blood group) |
| Genbank accession: | NM_139030 |
| Immunogen: | A synthetic peptide corresponding to C-terminus of human CD151. |
| Immunogen sequence/protein sequence: | HCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYK |
| Protein accession: | NP_620599;P48509 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1:100) Western Blot (1 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human nasal epithelial cells with CD151 polyclonal antibody (Cat # PAB29946) at 1:100 dilution. |
| Applications: | WB-Ce,IF |
| Shipping condition: | Dry Ice |