Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STOM polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IF |
More info about STOM polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29945 |
| Product name: | STOM polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human STOM. |
| Gene id: | 2040 |
| Gene name: | STOM |
| Gene alias: | BND7|EPB7|EPB72 |
| Gene description: | stomatin |
| Genbank accession: | NM_004099 |
| Immunogen: | A synthetic peptide corresponding to C-terminus of human STOM. |
| Immunogen sequence/protein sequence: | LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY |
| Protein accession: | NP_004090;P27105 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1:150) Western Blot (1 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HeLa cell lysate with STOM polyclonal antibody (Cat # PAB29945) at 1 ug/mL working concentration. |
| Applications: | WB-Ce,IF |
| Shipping condition: | Dry Ice |