ADD3 polyclonal antibody View larger

ADD3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADD3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,IF

More info about ADD3 polyclonal antibody

Brand: Abnova
Reference: PAB29943
Product name: ADD3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human ADD3.
Gene id: 120
Gene name: ADD3
Gene alias: ADDL
Gene description: adducin 3 (gamma)
Genbank accession: NM_016824
Immunogen: A synthetic peptide corresponding to internal region of human ADD3.
Immunogen sequence/protein sequence: AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI
Protein accession: NP_058432;Q9UEY8
Form: Liquid
Recommend dilutions: Immunofluorescence (1:500)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: PAB29943-46-121-1.jpg
Application image note: Western Blot analysis of PANC-1 cell lysate with ADD3 polyclonal antibody (Cat # PAB29943) at 0.2-1 ug/mL working concentration.
Applications: WB-Ce,IF
Shipping condition: Dry Ice

Reviews

Buy ADD3 polyclonal antibody now

Add to cart