CPS1 polyclonal antibody View larger

CPS1 polyclonal antibody

New product

369,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPS1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Pig
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about CPS1 polyclonal antibody

Brand: Abnova
Reference: PAB29926
Product name: CPS1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human CPS1.
Gene id: 1373
Gene name: CPS1
Gene alias: -
Gene description: carbamoyl-phosphate synthetase 1, mitochondrial
Genbank accession: NM_001875
Immunogen: A synthetic peptide corresponding to internal region of human CPS1.
Immunogen sequence/protein sequence: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
Protein accession: NP_001866;P31327
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Pig
Application image: PAB29926-48-multi-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine (A), pig ileum (B), pig duodenum (C) and pig kidney (D) with CPS1 polyclonal antibody (Cat # PAB29926).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CPS1 polyclonal antibody now

Add to cart