Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF3G polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | IP,IHC,WB-Ce |
More info about EIF3G polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29909 |
| Product name: | EIF3G polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human EIF3G. |
| Isotype: | IgG |
| Gene id: | 8666 |
| Gene name: | EIF3G |
| Gene alias: | EIF3-P42|EIF3S4|eIF3-delta|eIF3-p44 |
| Gene description: | eukaryotic translation initiation factor 3, subunit G |
| Immunogen: | A synthetic peptide corresponding to amino acids 218-267 of human EIF3G. |
| Immunogen sequence/protein sequence: | LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
| Protein accession: | O75821 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) Immunoprecipitation Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human brain stem cells with EIF3G polyclonal antibody (Cat # PAB29909). |
| Applications: | IP,IHC,WB-Ce |
| Shipping condition: | Dry Ice |