Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LHX3 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about LHX3 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29905 |
| Product name: | LHX3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human LHX3. |
| Isotype: | IgG |
| Gene id: | 8022 |
| Gene name: | LHX3 |
| Gene alias: | DKFZp762A2013|LIM3|M2-LHX3 |
| Gene description: | LIM homeobox 3 |
| Immunogen: | A synthetic peptide corresponding to 50 amino acids at the internal region of human LHX3. |
| Immunogen sequence/protein sequence: | QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV |
| Protein accession: | Q9UBR4-2 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of (A) human lung and (B) human heart tissues with LHX3 polyclonal antibody (Cat # PAB29905). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |