Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB29886 |
Product name: | KCNQ2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human KCNQ2. |
Isotype: | IgG |
Gene id: | 3785 |
Gene name: | KCNQ2 |
Gene alias: | BFNC|EBN|EBN1|ENB1|HNSPC|KCNA11|KV7.2|KVEBN1 |
Gene description: | potassium voltage-gated channel, KQT-like subfamily, member 2 |
Immunogen: | A synthetic peptide corresponding to amino acids 189-238 of human KCNQ2. |
Immunogen sequence/protein sequence: | GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Protein accession: | Q5VYU0 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with KCNQ2 polyclonal antibody (Cat # PAB29886). |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |