Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB29879 |
Product name: | SF3A1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human SF3A1. |
Isotype: | IgG |
Gene id: | 10291 |
Gene name: | SF3A1 |
Gene alias: | PRP21|PRPF21|SAP114|SF3A120 |
Gene description: | splicing factor 3a, subunit 1, 120kDa |
Immunogen: | A synthetic peptide corresponding to amino acids 121-170 of human SF3A1. |
Immunogen sequence/protein sequence: | QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
Protein accession: | Q15459 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1:250) Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide). |
Storage instruction: | Store at 4°C for up to 1 week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart with SF3A1 polyclonal antibody (Cat # PAB29879). |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |