OVOL2 polyclonal antibody View larger

OVOL2 polyclonal antibody

New product

375,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OVOL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Ce,IF

More info about OVOL2 polyclonal antibody

Product description: Rabbit polyclonal antibody raised against partial synthetic protein of human OVOL2.
Isotype: IgG
Gene id: 58495
Gene name: OVOL2
Gene alias: EUROIMAGE566589|ZNF339
Gene description: ovo-like 2 (Drosophila)
Immunogen: A synthetic peptide corresponding to amino acids 226-275 of human OVOL2.
Immunogen sequence/protein sequence: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Protein accession: Q9BRP0
Form: Liquid
Recommend dilutions: Immunofluorescence
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C for up to 1 week. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Size: 100 uL
Shipping condition: Dry Ice

Reviews

Buy OVOL2 polyclonal antibody now

Add to cart