LAIR1 polyclonal antibody View larger

LAIR1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAIR1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about LAIR1 polyclonal antibody

Brand: Abnova
Reference: PAB29577
Product name: LAIR1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human LAIR1.
Isotype: IgG
Gene id: 3903
Gene name: LAIR1
Gene alias: CD305|LAIR-1
Gene description: leukocyte-associated immunoglobulin-like receptor 1
Immunogen: Recombinant protein corresponding to amino acids 187-287 of human LAIR1.
Immunogen sequence/protein sequence: HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Protein accession: Q6GTX8
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29577-48-10-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra with LAIR1 polyclonal antibody (Cat # PAB29577) at 1:200 - 1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAIR1 polyclonal antibody now

Add to cart