CD47 polyclonal antibody View larger

CD47 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD47 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CD47 polyclonal antibody

Brand: Abnova
Reference: PAB29568
Product name: CD47 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CD47.
Isotype: IgG
Gene id: 961
Gene name: CD47
Gene alias: IAP|MER6|OA3
Gene description: CD47 molecule
Immunogen: Recombinant protein corresponding to amino acids of human CD47.
Immunogen sequence/protein sequence: AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29568-48-39-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with CD47 polyclonal antibody (Cat # PAB29568) shows strong cytoplasmic and membranous positivity in urothelial cells at 1:500 - 1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CD47 polyclonal antibody now

Add to cart