KIT polyclonal antibody View larger

KIT polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIT polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KIT polyclonal antibody

Brand: Abnova
Reference: PAB29551
Product name: KIT polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human KIT.
Isotype: IgG
Gene id: 3815
Gene name: KIT
Gene alias: C-Kit|CD117|PBT|SCFR
Gene description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Immunogen: Recombinant protein corresponding to human KIT.
Immunogen sequence/protein sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29551-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with KIT polyclonal antibody (Cat # PAB29551) show strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KIT polyclonal antibody now

Add to cart