IFIT2 polyclonal antibody View larger

IFIT2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFIT2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about IFIT2 polyclonal antibody

Brand: Abnova
Reference: PAB29545
Product name: IFIT2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human IFIT2.
Isotype: IgG
Gene id: 3433
Gene name: IFIT2
Gene alias: G10P2|GARG-39|IFI-54|IFI54|ISG-54K|ISG54|cig42
Gene description: interferon-induced protein with tetratricopeptide repeats 2
Immunogen: Recombinant protein corresponding to human IFIT2.
Immunogen sequence/protein sequence: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29545-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with IFIT2 polyclonal antibody (Cat # PAB29545) show strong cytoplasmic positivity in cells in tubules at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy IFIT2 polyclonal antibody now

Add to cart