DUSP9 polyclonal antibody View larger

DUSP9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about DUSP9 polyclonal antibody

Brand: Abnova
Reference: PAB29541
Product name: DUSP9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human DUSP9.
Isotype: IgG
Gene id: 1852
Gene name: DUSP9
Gene alias: MKP-4|MKP4
Gene description: dual specificity phosphatase 9
Immunogen: Recombinant protein corresponding to human DUSP9.
Immunogen sequence/protein sequence: ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29541-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with DUSP9 polyclonal antibody (Cat # PAB29541) shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DUSP9 polyclonal antibody now

Add to cart