ELF3 polyclonal antibody View larger

ELF3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELF3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ELF3 polyclonal antibody

Brand: Abnova
Reference: PAB29538
Product name: ELF3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ELF3.
Isotype: IgG
Gene id: 1999
Gene name: ELF3
Gene alias: EPR-1|ERT|ESE-1|ESX
Gene description: E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Immunogen: Recombinant protein corresponding to human ELF3.
Immunogen sequence/protein sequence: QASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29538-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with ELF3 polyclonal antibody (Cat # PAB29538) shows strong nuclear positivity in urothelial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ELF3 polyclonal antibody now

Add to cart