UBE2E3 polyclonal antibody View larger

UBE2E3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2E3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about UBE2E3 polyclonal antibody

Brand: Abnova
Reference: PAB29537
Product name: UBE2E3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human UBE2E3.
Isotype: IgG
Gene id: 10477
Gene name: UBE2E3
Gene alias: UBCH9|UbcM2
Gene description: ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Immunogen: Recombinant protein corresponding to human UBE2E3.
Immunogen sequence/protein sequence: SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGV
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29537-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with UBE2E3 polyclonal antibody (Cat # PAB29537) shows cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UBE2E3 polyclonal antibody now

Add to cart