NEUROD1 polyclonal antibody View larger

NEUROD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about NEUROD1 polyclonal antibody

Brand: Abnova
Reference: PAB29535
Product name: NEUROD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NEUROD1.
Isotype: IgG
Gene id: 4760
Gene name: NEUROD1
Gene alias: BETA2|BHF-1|NEUROD|bHLHa3
Gene description: neurogenic differentiation 1
Immunogen: Recombinant protein corresponding to human NEUROD1.
Immunogen sequence/protein sequence: ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29535-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with NEUROD1 polyclonal antibody (Cat # PAB29535) shows strong cytoplasmic positivity in smooth muscle cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NEUROD1 polyclonal antibody now

Add to cart