CUX1 polyclonal antibody View larger

CUX1 polyclonal antibody

PAB29534_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CUX1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CUX1 polyclonal antibody

Brand: Abnova
Reference: PAB29534
Product name: CUX1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CUX1.
Isotype: IgG
Gene id: 1523
Gene name: CUX1
Gene alias: CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene description: cut-like homeobox 1
Immunogen: Recombinant protein corresponding to human CUX1.
Immunogen sequence/protein sequence: LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29534-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with CUX1 polyclonal antibody (Cat # PAB29534) shows strong nuclear positivity in reaction center cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CUX1 polyclonal antibody now

Add to cart