CCT2 polyclonal antibody View larger

CCT2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCT2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CCT2 polyclonal antibody

Brand: Abnova
Reference: PAB29532
Product name: CCT2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CCT2.
Isotype: IgG
Gene id: 10576
Gene name: CCT2
Gene alias: 99D8.1|CCT-beta|CCTB|MGC142074|MGC142076|PRO1633|TCP-1-beta
Gene description: chaperonin containing TCP1, subunit 2 (beta)
Immunogen: Recombinant protein corresponding to human CCT2.
Immunogen sequence/protein sequence: DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29532-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with CCT2 polyclonal antibody (Cat # PAB29532) shows moderate positivity in chief cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CCT2 polyclonal antibody now

Add to cart