Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB29532 |
Product name: | CCT2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human CCT2. |
Isotype: | IgG |
Gene id: | 10576 |
Gene name: | CCT2 |
Gene alias: | 99D8.1|CCT-beta|CCTB|MGC142074|MGC142076|PRO1633|TCP-1-beta |
Gene description: | chaperonin containing TCP1, subunit 2 (beta) |
Immunogen: | Recombinant protein corresponding to human CCT2. |
Immunogen sequence/protein sequence: | DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human stomach with CCT2 polyclonal antibody (Cat # PAB29532) shows moderate positivity in chief cells. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |