MB polyclonal antibody View larger

MB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MB polyclonal antibody

Brand: Abnova
Reference: PAB29530
Product name: MB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human MB.
Isotype: IgG
Gene id: 4151
Gene name: MB
Gene alias: MGC13548|PVALB
Gene description: myoglobin
Immunogen: Recombinant protein corresponding to human MB.
Immunogen sequence/protein sequence: DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29530-48-188-1.jpg
Application image note: Immunohistochemical staining of human heart muscle with MB polyclonal antibody (Cat # PAB29530) shows strong cytoplasmic and nuclear positivity in myocytes at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MB polyclonal antibody now

Add to cart