PDE4B polyclonal antibody View larger

PDE4B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE4B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PDE4B polyclonal antibody

Brand: Abnova
Reference: PAB29528
Product name: PDE4B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human PDE4B.
Isotype: IgG
Gene id: 5142
Gene name: PDE4B
Gene alias: DKFZp686F2182|DPDE4|MGC126529|PDE4B5|PDEIVB
Gene description: phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
Immunogen: Recombinant protein corresponding to human PDE4B.
Immunogen sequence/protein sequence: SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29528-48-301-1.jpg
Application image note: Immunohistochemical staining of human epididymis with PDE4B polyclonal antibody (Cat # PAB29528) shows strong cytoplasmic positivity with granular pattern in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PDE4B polyclonal antibody now

Add to cart