SYP polyclonal antibody View larger

SYP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SYP polyclonal antibody

Brand: Abnova
Reference: PAB29526
Product name: SYP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human SYP.
Isotype: IgG
Gene id: 6855
Gene name: SYP
Gene alias: -
Gene description: synaptophysin
Immunogen: Recombinant protein corresponding to human SYP.
Immunogen sequence/protein sequence: DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29526-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with SYP polyclonal antibody (Cat # PAB29526) shows distinct positivity in neuropil.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SYP polyclonal antibody now

Add to cart