TLR8 polyclonal antibody View larger

TLR8 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TLR8 polyclonal antibody

Brand: Abnova
Reference: PAB29521
Product name: TLR8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human TLR8.
Isotype: IgG
Gene id: 51311
Gene name: TLR8
Gene alias: CD288|MGC119599|MGC119600
Gene description: toll-like receptor 8
Immunogen: Recombinant protein corresponding to human TLR8.
Immunogen sequence/protein sequence: RSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29521-48-9-1.jpg
Application image note: Immunohistochemical staining of human spleen with TLR8 polyclonal antibody (Cat # PAB29521) shows distinct cytoplasmic positivity in cells in red pulp at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TLR8 polyclonal antibody now

Add to cart