NBN polyclonal antibody View larger

NBN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about NBN polyclonal antibody

Brand: Abnova
Reference: PAB29518
Product name: NBN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NBN.
Isotype: IgG
Gene id: 4683
Gene name: NBN
Gene alias: AT-V1|AT-V2|ATV|FLJ10155|MGC87362|NBS|NBS1|P95
Gene description: nibrin
Immunogen: Recombinant protein corresponding to human NBN.
Immunogen sequence/protein sequence: DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29518-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with NBN polyclonal antibody (Cat # PAB29518) shows strong nuclear positivity in cells of seminiferus ducts.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy NBN polyclonal antibody now

Add to cart