ZC3H12B polyclonal antibody View larger

ZC3H12B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZC3H12B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about ZC3H12B polyclonal antibody

Brand: Abnova
Reference: PAB29510
Product name: ZC3H12B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ZC3H12B.
Isotype: IgG
Gene id: 340554
Gene name: ZC3H12B
Gene alias: CXorf32|MCPIP2
Gene description: zinc finger CCCH-type containing 12B
Immunogen: Recombinant protein corresponding to human ZC3H12B.
Immunogen sequence/protein sequence: GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQHASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYKNLCN
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29510-48-5-1.jpg
Application image note: Immunohistochemical staining of human tonsil with ZC3H12B polyclonal antibody (Cat # PAB29510) shows distinct cytoplasmic positivity in subsets of cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZC3H12B polyclonal antibody now

Add to cart