UBA1 polyclonal antibody View larger

UBA1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBA1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about UBA1 polyclonal antibody

Brand: Abnova
Reference: PAB29508
Product name: UBA1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human UBA1.
Isotype: IgG
Gene id: 7317
Gene name: UBA1
Gene alias: A1S9|A1S9T|A1ST|AMCX1|GXP1|MGC4781|SMAX2|UBA1A|UBE1|UBE1X
Gene description: ubiquitin-like modifier activating enzyme 1
Immunogen: Recombinant protein corresponding to human UBA1.
Immunogen sequence/protein sequence: LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB29508-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with UBA1 polyclonal antibody (Cat # PAB29508) shows distinct nuclear positivity in glial cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy UBA1 polyclonal antibody now

Add to cart