CD83 polyclonal antibody View larger

CD83 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD83 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about CD83 polyclonal antibody

Brand: Abnova
Reference: PAB29493
Product name: CD83 polyclonal antibody
Product description: CD83 polyclonal antibody raised against recombinant human CD83.
Isotype: IgG
Gene id: 9308
Gene name: CD83
Gene alias: BL11|HB15
Gene description: CD83 molecule
Immunogen: Recombinant protein corresponding to amino acids of human CD83.
Immunogen sequence/protein sequence: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET
Protein accession: Q01151
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29493-48-5-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CD83 polyclonal antibody (Cat# PAB29493) shows distinct positivity in a subset of leukocytes.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CD83 polyclonal antibody now

Add to cart