NCAM1 polyclonal antibody View larger

NCAM1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCAM1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about NCAM1 polyclonal antibody

Brand: Abnova
Reference: PAB29492
Product name: NCAM1 polyclonal antibody
Product description: NCAM1 polyclonal antibody raised against recombinant human NCAM1.
Isotype: IgG
Gene id: 4684
Gene name: NCAM1
Gene alias: CD56|MSK39|NCAM
Gene description: neural cell adhesion molecule 1
Immunogen: Recombinant protein corresponding to amino acids of human NCAM1.
Immunogen sequence/protein sequence: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29492-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with NCAM1 polyclonal antibody (Cat# PAB29492) shows distinct positivity in neuropil at 1:50 - 1:200 dilution.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NCAM1 polyclonal antibody now

Add to cart