FCAR polyclonal antibody View larger

FCAR polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FCAR polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about FCAR polyclonal antibody

Brand: Abnova
Reference: PAB29489
Product name: FCAR polyclonal antibody
Product description: FCAR polyclonal antibody raised against recombinant human FCAR.
Isotype: IgG
Gene id: 2204
Gene name: FCAR
Gene alias: CD89
Gene description: Fc fragment of IgA, receptor for
Immunogen: Recombinant protein corresponding to amino acids of human FCAR.
Immunogen sequence/protein sequence: NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Protein accession: P24071
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29489-48-10-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with FCAR polyclonal antibody (Cat# PAB29489) shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra at 1:50 - 1:200 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy FCAR polyclonal antibody now

Add to cart