TNFRSF14 polyclonal antibody View larger

TNFRSF14 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF14 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TNFRSF14 polyclonal antibody

Brand: Abnova
Reference: PAB29485
Product name: TNFRSF14 polyclonal antibody
Product description: TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.
Isotype: IgG
Gene id: 8764
Gene name: TNFRSF14
Gene alias: ATAR|HVEA|HVEM|LIGHTR|TR2
Gene description: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Immunogen: Recombinant protein corresponding to amino acids of human TNFRSF14.
Immunogen sequence/protein sequence: PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Protein accession: Q92956
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29485-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with TNFRSF14 polyclonal antibody (Cat# PAB29485) shows strong cytoplasmic positivity in glandular cells at 1:20 - 1:50 dilution.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TNFRSF14 polyclonal antibody now

Add to cart